LIN37 Antikörper

Produktnummer ABIN632413

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch LIN37 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für LIN37 Antikörper (ABIN632413)

Target: LIN37 (Lin-37 Homolog (LIN37))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIN37 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LIN37 Antikörper

Aufreinigung: Affinity purified

Immunogen: LIN37 antibody was raised using a synthetic peptide corresponding to a region with amino acids HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIN37 Blocking Peptide, (ABIN939214), is also available for use as a blocking control in assays to test for specificity of this LIN37 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN37 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIN37

Target: LIN37 (Lin-37 Homolog (LIN37))

Andere Bezeichnung: LIN37

Hintergrund: This gene encodes a protein expressed in the eye.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Zellzyklus, Mitotic G1-G1/S Phases